The effect of peptide size on target affinity in mRNA display-derived macrocyclic peptides. Jing, X., Suh, J., Maxwell, J., Norman, A., Reid, X., J., Deshpande, C., Low, J., K., K., Payne, R., J., Passioura, T., & Mackay, J., P. Chem Commun, 62(13):4028-4031, 2026. bibtex @article{
title = {The effect of peptide size on target affinity in mRNA display-derived macrocyclic peptides},
type = {article},
year = {2026},
pages = {4028-4031},
volume = {62},
id = {6604ed88-d088-31dc-8402-995155ebed01},
created = {2026-05-27T03:42:48.771Z},
file_attached = {false},
profile_id = {a5a2ab6f-a8b5-3db6-97bc-618752ee4386},
group_id = {bc1ab1d4-9e57-37e6-9fb5-435fca0ee9d2},
last_modified = {2026-05-27T03:42:48.771Z},
read = {false},
starred = {false},
authored = {false},
confirmed = {false},
hidden = {false},
source_type = {article},
private_publication = {false},
bibtype = {article},
author = {Jing, X and Suh, J and Maxwell, J and Norman, A and Reid, X J and Deshpande, C and Low, J K K and Payne, R J and Passioura, T and Mackay, J P},
journal = {Chem Commun},
number = {13}
}
Downloads: 0
{"_id":"J8g2jA3Zxo2Dg9H76","bibbaseid":"jing-suh-maxwell-norman-reid-deshpande-low-payne-etal-theeffectofpeptidesizeontargetaffinityinmrnadisplayderivedmacrocyclicpeptides-2026","author_short":["Jing, X.","Suh, J.","Maxwell, J.","Norman, A.","Reid, X., J.","Deshpande, C.","Low, J., K., K.","Payne, R., J.","Passioura, T.","Mackay, J., P."],"bibdata":{"title":"The effect of peptide size on target affinity in mRNA display-derived macrocyclic peptides","type":"article","year":"2026","pages":"4028-4031","volume":"62","id":"6604ed88-d088-31dc-8402-995155ebed01","created":"2026-05-27T03:42:48.771Z","file_attached":false,"profile_id":"a5a2ab6f-a8b5-3db6-97bc-618752ee4386","group_id":"bc1ab1d4-9e57-37e6-9fb5-435fca0ee9d2","last_modified":"2026-05-27T03:42:48.771Z","read":false,"starred":false,"authored":false,"confirmed":false,"hidden":false,"source_type":"article","private_publication":false,"bibtype":"article","author":"Jing, X and Suh, J and Maxwell, J and Norman, A and Reid, X J and Deshpande, C and Low, J K K and Payne, R J and Passioura, T and Mackay, J P","journal":"Chem Commun","number":"13","bibtex":"@article{\n title = {The effect of peptide size on target affinity in mRNA display-derived macrocyclic peptides},\n type = {article},\n year = {2026},\n pages = {4028-4031},\n volume = {62},\n id = {6604ed88-d088-31dc-8402-995155ebed01},\n created = {2026-05-27T03:42:48.771Z},\n file_attached = {false},\n profile_id = {a5a2ab6f-a8b5-3db6-97bc-618752ee4386},\n group_id = {bc1ab1d4-9e57-37e6-9fb5-435fca0ee9d2},\n last_modified = {2026-05-27T03:42:48.771Z},\n read = {false},\n starred = {false},\n authored = {false},\n confirmed = {false},\n hidden = {false},\n source_type = {article},\n private_publication = {false},\n bibtype = {article},\n author = {Jing, X and Suh, J and Maxwell, J and Norman, A and Reid, X J and Deshpande, C and Low, J K K and Payne, R J and Passioura, T and Mackay, J P},\n journal = {Chem Commun},\n number = {13}\n}","author_short":["Jing, X.","Suh, J.","Maxwell, J.","Norman, A.","Reid, X., J.","Deshpande, C.","Low, J., K., K.","Payne, R., J.","Passioura, T.","Mackay, J., P."],"biburl":"https://bibbase.org/service/mendeley/a5a2ab6f-a8b5-3db6-97bc-618752ee4386","bibbaseid":"jing-suh-maxwell-norman-reid-deshpande-low-payne-etal-theeffectofpeptidesizeontargetaffinityinmrnadisplayderivedmacrocyclicpeptides-2026","role":"author","urls":{},"metadata":{"authorlinks":{}}},"bibtype":"article","biburl":"https://bibbase.org/service/mendeley/a5a2ab6f-a8b5-3db6-97bc-618752ee4386","dataSources":["ibLPPAndxdcRpxcwH","2252seNhipfTmjEBQ"],"keywords":[],"search_terms":["effect","peptide","size","target","affinity","mrna","display","derived","macrocyclic","peptides","jing","suh","maxwell","norman","reid","deshpande","low","payne","passioura","mackay"],"title":"The effect of peptide size on target affinity in mRNA display-derived macrocyclic peptides","year":2026}