Investigating the Impact of Hydrophobic Polymer Segments on the Self-Assembly Behavior of Supramolecular Cyclic Peptide Systems via Asymmetric-Flow Field Flow Fractionation. Kariuki, M., Rho, J. Y., Hall, S. C. L., & Perrier, S. MACROMOLECULES, 56(17):6618–6632, August, 2023. doi abstract bibtex The present study examines the behavior of cyclic peptide polymer conjugates that have been designed to combine their self-assembling ability via H-bonding with the properties of amphiphilic diblock copolymers. Using a combination of asymmetric flow-field flow fractionation (AF(4)) and small-angle neutron scattering (SANS), we have uncovered unique insight based on the population of structures established at a 24 h equilibrium profile. Our results determine that by introducing a small quantity of hydrophobicity into the conjugated polymer corona, the resulting nanotube structures exhibit low unimer dissociation which signifies enhanced stability. Furthermore, as the hydrophobicity of the polymer corona is increased, the elongation of the nanotubes is observed due to an increase in the association of unimers. This encompasses not only the H-bonding of unimers into nanotubes but also the self-assembly of single nanotubes into segmented-nanotube structures with high aspect ratios. However, this influence relies on a subtle balance between the hydrophobicity and hydrophilicity of the polymer corona. This balance is proposed to determine the solvent entropic penalty of hydrating the system, whereby the cost scales with the hydrophobic quantity. Consequently, it has been suggested that at a critical hydrophobic quantity, the solvation penalty becomes high enough such that the self-assembly of the system deviates from ordered hydrogen bonding. The association behavior is instead dominated by the hydrophobic effect which results in the undesirable formation of disordered aggregates.
@article{kariuki_investigating_2023,
title = {Investigating the {Impact} of {Hydrophobic} {Polymer} {Segments} on the {Self}-{Assembly} {Behavior} of {Supramolecular} {Cyclic} {Peptide} {Systems} via {Asymmetric}-{Flow} {Field} {Flow} {Fractionation}},
volume = {56},
issn = {0024-9297},
doi = {10.1021/acs.macromol.3c00442},
abstract = {The present study examines the behavior of cyclic peptide polymer conjugates that have been designed to combine their self-assembling ability via H-bonding with the properties of amphiphilic diblock copolymers. Using a combination of asymmetric flow-field flow fractionation (AF(4)) and small-angle neutron scattering (SANS), we have uncovered unique insight based on the population of structures established at a 24 h equilibrium profile. Our results determine that by introducing a small quantity of hydrophobicity into the conjugated polymer corona, the resulting nanotube structures exhibit low unimer dissociation which signifies enhanced stability. Furthermore, as the hydrophobicity of the polymer corona is increased, the elongation of the nanotubes is observed due to an increase in the association of unimers. This encompasses not only the H-bonding of unimers into nanotubes but also the self-assembly of single nanotubes into segmented-nanotube structures with high aspect ratios. However, this influence relies on a subtle balance between the hydrophobicity and hydrophilicity of the polymer corona. This balance is proposed to determine the solvent entropic penalty of hydrating the system, whereby the cost scales with the hydrophobic quantity. Consequently, it has been suggested that at a critical hydrophobic quantity, the solvation penalty becomes high enough such that the self-assembly of the system deviates from ordered hydrogen bonding. The association behavior is instead dominated by the hydrophobic effect which results in the undesirable formation of disordered aggregates.},
number = {17},
urldate = {2024-03-30},
journal = {MACROMOLECULES},
author = {Kariuki, Maria and Rho, Julia Y. and Hall, Stephen C. L. and Perrier, Sebastien},
month = aug,
year = {2023},
pages = {6618--6632},
}
Downloads: 0
{"_id":"dH2EkY7h4mxd5fygN","bibbaseid":"kariuki-rho-hall-perrier-investigatingtheimpactofhydrophobicpolymersegmentsontheselfassemblybehaviorofsupramolecularcyclicpeptidesystemsviaasymmetricflowfieldflowfractionation-2023","author_short":["Kariuki, M.","Rho, J. Y.","Hall, S. C. L.","Perrier, S."],"bibdata":{"bibtype":"article","type":"article","title":"Investigating the Impact of Hydrophobic Polymer Segments on the Self-Assembly Behavior of Supramolecular Cyclic Peptide Systems via Asymmetric-Flow Field Flow Fractionation","volume":"56","issn":"0024-9297","doi":"10.1021/acs.macromol.3c00442","abstract":"The present study examines the behavior of cyclic peptide polymer conjugates that have been designed to combine their self-assembling ability via H-bonding with the properties of amphiphilic diblock copolymers. Using a combination of asymmetric flow-field flow fractionation (AF(4)) and small-angle neutron scattering (SANS), we have uncovered unique insight based on the population of structures established at a 24 h equilibrium profile. Our results determine that by introducing a small quantity of hydrophobicity into the conjugated polymer corona, the resulting nanotube structures exhibit low unimer dissociation which signifies enhanced stability. Furthermore, as the hydrophobicity of the polymer corona is increased, the elongation of the nanotubes is observed due to an increase in the association of unimers. This encompasses not only the H-bonding of unimers into nanotubes but also the self-assembly of single nanotubes into segmented-nanotube structures with high aspect ratios. However, this influence relies on a subtle balance between the hydrophobicity and hydrophilicity of the polymer corona. This balance is proposed to determine the solvent entropic penalty of hydrating the system, whereby the cost scales with the hydrophobic quantity. Consequently, it has been suggested that at a critical hydrophobic quantity, the solvation penalty becomes high enough such that the self-assembly of the system deviates from ordered hydrogen bonding. The association behavior is instead dominated by the hydrophobic effect which results in the undesirable formation of disordered aggregates.","number":"17","urldate":"2024-03-30","journal":"MACROMOLECULES","author":[{"propositions":[],"lastnames":["Kariuki"],"firstnames":["Maria"],"suffixes":[]},{"propositions":[],"lastnames":["Rho"],"firstnames":["Julia","Y."],"suffixes":[]},{"propositions":[],"lastnames":["Hall"],"firstnames":["Stephen","C.","L."],"suffixes":[]},{"propositions":[],"lastnames":["Perrier"],"firstnames":["Sebastien"],"suffixes":[]}],"month":"August","year":"2023","pages":"6618–6632","bibtex":"@article{kariuki_investigating_2023,\n\ttitle = {Investigating the {Impact} of {Hydrophobic} {Polymer} {Segments} on the {Self}-{Assembly} {Behavior} of {Supramolecular} {Cyclic} {Peptide} {Systems} via {Asymmetric}-{Flow} {Field} {Flow} {Fractionation}},\n\tvolume = {56},\n\tissn = {0024-9297},\n\tdoi = {10.1021/acs.macromol.3c00442},\n\tabstract = {The present study examines the behavior of cyclic peptide polymer conjugates that have been designed to combine their self-assembling ability via H-bonding with the properties of amphiphilic diblock copolymers. Using a combination of asymmetric flow-field flow fractionation (AF(4)) and small-angle neutron scattering (SANS), we have uncovered unique insight based on the population of structures established at a 24 h equilibrium profile. Our results determine that by introducing a small quantity of hydrophobicity into the conjugated polymer corona, the resulting nanotube structures exhibit low unimer dissociation which signifies enhanced stability. Furthermore, as the hydrophobicity of the polymer corona is increased, the elongation of the nanotubes is observed due to an increase in the association of unimers. This encompasses not only the H-bonding of unimers into nanotubes but also the self-assembly of single nanotubes into segmented-nanotube structures with high aspect ratios. However, this influence relies on a subtle balance between the hydrophobicity and hydrophilicity of the polymer corona. This balance is proposed to determine the solvent entropic penalty of hydrating the system, whereby the cost scales with the hydrophobic quantity. Consequently, it has been suggested that at a critical hydrophobic quantity, the solvation penalty becomes high enough such that the self-assembly of the system deviates from ordered hydrogen bonding. The association behavior is instead dominated by the hydrophobic effect which results in the undesirable formation of disordered aggregates.},\n\tnumber = {17},\n\turldate = {2024-03-30},\n\tjournal = {MACROMOLECULES},\n\tauthor = {Kariuki, Maria and Rho, Julia Y. and Hall, Stephen C. L. and Perrier, Sebastien},\n\tmonth = aug,\n\tyear = {2023},\n\tpages = {6618--6632},\n}\n\n","author_short":["Kariuki, M.","Rho, J. Y.","Hall, S. C. L.","Perrier, S."],"key":"kariuki_investigating_2023","id":"kariuki_investigating_2023","bibbaseid":"kariuki-rho-hall-perrier-investigatingtheimpactofhydrophobicpolymersegmentsontheselfassemblybehaviorofsupramolecularcyclicpeptidesystemsviaasymmetricflowfieldflowfractionation-2023","role":"author","urls":{},"metadata":{"authorlinks":{}},"html":""},"bibtype":"article","biburl":"https://https-warwick-ac-uk-443.webvpn.ynu.edu.cn/fac/cross_fac/wesic/research/wpg/research/WPGsep2024.bib","dataSources":["m4fxWT6XKrYfGbZFR","GBhqMC9hjyD5vqptk","6idaYK6okJY39mWgG","QrXKmxXYzzDzmnPHf"],"keywords":[],"search_terms":["investigating","impact","hydrophobic","polymer","segments","self","assembly","behavior","supramolecular","cyclic","peptide","systems","via","asymmetric","flow","field","flow","fractionation","kariuki","rho","hall","perrier"],"title":"Investigating the Impact of Hydrophobic Polymer Segments on the Self-Assembly Behavior of Supramolecular Cyclic Peptide Systems via Asymmetric-Flow Field Flow Fractionation","year":2023}