Plant biomechanics and resilience to environmental changes are controlled by specific lignin chemistries in each vascular cell type and morphotype. Ménard, D., Blaschek, L., Kriechbaum, K., Lee, C. C., Serk, H., Zhu, C., Lyubartsev, A., Nuoendagula, Bacsik, Z., Bergström, L., Mathew, A., Kajita, S., & Pesquet, E. The Plant Cell, 34(12):4877–4896, December, 2022.
Paper doi abstract bibtex The biopolymer lignin is deposited in the cell walls of vascular cells and is essential for long-distance water conduction and structural support in plants. Different vascular cell types contain distinct and conserved lignin chemistries, each with specific aromatic and aliphatic substitutions. Yet, the biological role of this conserved and specific lignin chemistry in each cell type remains unclear. Here, we investigated the roles of this lignin biochemical specificity for cellular functions by producing single cell analyses for three cell morphotypes of tracheary elements, which all allow sap conduction but differ in their morphology. We determined that specific lignin chemistries accumulate in each cell type. Moreover, lignin accumulated dynamically, increasing in quantity and changing in composition, to alter the cell wall biomechanics during cell maturation. For similar aromatic substitutions, residues with alcohol aliphatic functions increased stiffness whereas aldehydes increased flexibility of the cell wall. Modifying this lignin biochemical specificity and the sequence of its formation impaired the cell wall biomechanics of each morphotype and consequently hindered sap conduction and drought recovery. Together, our results demonstrate that each sap-conducting vascular cell type distinctly controls their lignin biochemistry to adjust their biomechanics and hydraulic properties to face developmental and environmental constraints.
@article{menard_plant_2022,
title = {Plant biomechanics and resilience to environmental changes are controlled by specific lignin chemistries in each vascular cell type and morphotype},
volume = {34},
issn = {1040-4651},
url = {https://doi.org/10.1093/plcell/koac284},
doi = {10.1093/plcell/koac284},
abstract = {The biopolymer lignin is deposited in the cell walls of vascular cells and is essential for long-distance water conduction and structural support in plants. Different vascular cell types contain distinct and conserved lignin chemistries, each with specific aromatic and aliphatic substitutions. Yet, the biological role of this conserved and specific lignin chemistry in each cell type remains unclear. Here, we investigated the roles of this lignin biochemical specificity for cellular functions by producing single cell analyses for three cell morphotypes of tracheary elements, which all allow sap conduction but differ in their morphology. We determined that specific lignin chemistries accumulate in each cell type. Moreover, lignin accumulated dynamically, increasing in quantity and changing in composition, to alter the cell wall biomechanics during cell maturation. For similar aromatic substitutions, residues with alcohol aliphatic functions increased stiffness whereas aldehydes increased flexibility of the cell wall. Modifying this lignin biochemical specificity and the sequence of its formation impaired the cell wall biomechanics of each morphotype and consequently hindered sap conduction and drought recovery. Together, our results demonstrate that each sap-conducting vascular cell type distinctly controls their lignin biochemistry to adjust their biomechanics and hydraulic properties to face developmental and environmental constraints.},
number = {12},
urldate = {2026-01-30},
journal = {The Plant Cell},
author = {Ménard, Delphine and Blaschek, Leonard and Kriechbaum, Konstantin and Lee, Cheng Choo and Serk, Henrik and Zhu, Chuantao and Lyubartsev, Alexander and {Nuoendagula} and Bacsik, Zoltán and Bergström, Lennart and Mathew, Aji and Kajita, Shinya and Pesquet, Edouard},
month = dec,
year = {2022},
pages = {4877--4896},
}
Downloads: 0
{"_id":"CJKwZvC2rFjcq6MJ3","bibbaseid":"mnard-blaschek-kriechbaum-lee-serk-zhu-lyubartsev-nuoendagula-etal-plantbiomechanicsandresiliencetoenvironmentalchangesarecontrolledbyspecificligninchemistriesineachvascularcelltypeandmorphotype-2022","author_short":["Ménard, D.","Blaschek, L.","Kriechbaum, K.","Lee, C. C.","Serk, H.","Zhu, C.","Lyubartsev, A.","Nuoendagula","Bacsik, Z.","Bergström, L.","Mathew, A.","Kajita, S.","Pesquet, E."],"bibdata":{"bibtype":"article","type":"article","title":"Plant biomechanics and resilience to environmental changes are controlled by specific lignin chemistries in each vascular cell type and morphotype","volume":"34","issn":"1040-4651","url":"https://doi.org/10.1093/plcell/koac284","doi":"10.1093/plcell/koac284","abstract":"The biopolymer lignin is deposited in the cell walls of vascular cells and is essential for long-distance water conduction and structural support in plants. Different vascular cell types contain distinct and conserved lignin chemistries, each with specific aromatic and aliphatic substitutions. Yet, the biological role of this conserved and specific lignin chemistry in each cell type remains unclear. Here, we investigated the roles of this lignin biochemical specificity for cellular functions by producing single cell analyses for three cell morphotypes of tracheary elements, which all allow sap conduction but differ in their morphology. We determined that specific lignin chemistries accumulate in each cell type. Moreover, lignin accumulated dynamically, increasing in quantity and changing in composition, to alter the cell wall biomechanics during cell maturation. For similar aromatic substitutions, residues with alcohol aliphatic functions increased stiffness whereas aldehydes increased flexibility of the cell wall. Modifying this lignin biochemical specificity and the sequence of its formation impaired the cell wall biomechanics of each morphotype and consequently hindered sap conduction and drought recovery. Together, our results demonstrate that each sap-conducting vascular cell type distinctly controls their lignin biochemistry to adjust their biomechanics and hydraulic properties to face developmental and environmental constraints.","number":"12","urldate":"2026-01-30","journal":"The Plant Cell","author":[{"propositions":[],"lastnames":["Ménard"],"firstnames":["Delphine"],"suffixes":[]},{"propositions":[],"lastnames":["Blaschek"],"firstnames":["Leonard"],"suffixes":[]},{"propositions":[],"lastnames":["Kriechbaum"],"firstnames":["Konstantin"],"suffixes":[]},{"propositions":[],"lastnames":["Lee"],"firstnames":["Cheng","Choo"],"suffixes":[]},{"propositions":[],"lastnames":["Serk"],"firstnames":["Henrik"],"suffixes":[]},{"propositions":[],"lastnames":["Zhu"],"firstnames":["Chuantao"],"suffixes":[]},{"propositions":[],"lastnames":["Lyubartsev"],"firstnames":["Alexander"],"suffixes":[]},{"firstnames":[],"propositions":[],"lastnames":["Nuoendagula"],"suffixes":[]},{"propositions":[],"lastnames":["Bacsik"],"firstnames":["Zoltán"],"suffixes":[]},{"propositions":[],"lastnames":["Bergström"],"firstnames":["Lennart"],"suffixes":[]},{"propositions":[],"lastnames":["Mathew"],"firstnames":["Aji"],"suffixes":[]},{"propositions":[],"lastnames":["Kajita"],"firstnames":["Shinya"],"suffixes":[]},{"propositions":[],"lastnames":["Pesquet"],"firstnames":["Edouard"],"suffixes":[]}],"month":"December","year":"2022","pages":"4877–4896","bibtex":"@article{menard_plant_2022,\n\ttitle = {Plant biomechanics and resilience to environmental changes are controlled by specific lignin chemistries in each vascular cell type and morphotype},\n\tvolume = {34},\n\tissn = {1040-4651},\n\turl = {https://doi.org/10.1093/plcell/koac284},\n\tdoi = {10.1093/plcell/koac284},\n\tabstract = {The biopolymer lignin is deposited in the cell walls of vascular cells and is essential for long-distance water conduction and structural support in plants. Different vascular cell types contain distinct and conserved lignin chemistries, each with specific aromatic and aliphatic substitutions. Yet, the biological role of this conserved and specific lignin chemistry in each cell type remains unclear. Here, we investigated the roles of this lignin biochemical specificity for cellular functions by producing single cell analyses for three cell morphotypes of tracheary elements, which all allow sap conduction but differ in their morphology. We determined that specific lignin chemistries accumulate in each cell type. Moreover, lignin accumulated dynamically, increasing in quantity and changing in composition, to alter the cell wall biomechanics during cell maturation. For similar aromatic substitutions, residues with alcohol aliphatic functions increased stiffness whereas aldehydes increased flexibility of the cell wall. Modifying this lignin biochemical specificity and the sequence of its formation impaired the cell wall biomechanics of each morphotype and consequently hindered sap conduction and drought recovery. Together, our results demonstrate that each sap-conducting vascular cell type distinctly controls their lignin biochemistry to adjust their biomechanics and hydraulic properties to face developmental and environmental constraints.},\n\tnumber = {12},\n\turldate = {2026-01-30},\n\tjournal = {The Plant Cell},\n\tauthor = {Ménard, Delphine and Blaschek, Leonard and Kriechbaum, Konstantin and Lee, Cheng Choo and Serk, Henrik and Zhu, Chuantao and Lyubartsev, Alexander and {Nuoendagula} and Bacsik, Zoltán and Bergström, Lennart and Mathew, Aji and Kajita, Shinya and Pesquet, Edouard},\n\tmonth = dec,\n\tyear = {2022},\n\tpages = {4877--4896},\n}\n\n\n\n","author_short":["Ménard, D.","Blaschek, L.","Kriechbaum, K.","Lee, C. C.","Serk, H.","Zhu, C.","Lyubartsev, A.","Nuoendagula","Bacsik, Z.","Bergström, L.","Mathew, A.","Kajita, S.","Pesquet, E."],"key":"menard_plant_2022","id":"menard_plant_2022","bibbaseid":"mnard-blaschek-kriechbaum-lee-serk-zhu-lyubartsev-nuoendagula-etal-plantbiomechanicsandresiliencetoenvironmentalchangesarecontrolledbyspecificligninchemistriesineachvascularcelltypeandmorphotype-2022","role":"author","urls":{"Paper":"https://doi.org/10.1093/plcell/koac284"},"metadata":{"authorlinks":{}}},"bibtype":"article","biburl":"https://bibbase.org/zotero/upscpub","dataSources":["9cGcv2t8pRzC92kzs"],"keywords":[],"search_terms":["plant","biomechanics","resilience","environmental","changes","controlled","specific","lignin","chemistries","each","vascular","cell","type","morphotype","ménard","blaschek","kriechbaum","lee","serk","zhu","lyubartsev","nuoendagula","bacsik","bergström","mathew","kajita","pesquet"],"title":"Plant biomechanics and resilience to environmental changes are controlled by specific lignin chemistries in each vascular cell type and morphotype","year":2022}