Revision of the Kelp Family Alariceae and the Taxonomic Affinities of Lessoniopsis-Reinke (Laminariales, Phaeophyta). Saunders, G. W. & Druehl, L. D. Hydrobiologia, 261:689–697, June, 1993. doi abstract bibtex The morphologically diverse members of the Laminariales are separated into three families, the Alariaceae, Laminariaceae and Lessoniaceae, on the basis of developmental features exhibited at the stipe-blade transition zone. We have investigated the relationships of lessoniacean taxa with those of alariacean and laminariacean affinity. This was done by completing phylogenetic analyses of 3' small-subunit (SSU) rRNA gene (113 bp), first internal transcribed spacer (ITS 1), 5.8S rRNA gene and second internal transcribed spacer (ITS2)(12 bp) sequence data from a variety of taxa. In summary, the Alariaceae and Lessoniaceae are polyphyletic. We present a restricted view of the Alariaceae, including only Alaria and Pterygophora of the genera usually placed in this family, and transfer the monotypic genus Lessoniopsis to this group. Current theories of kelp evolution and biogeography must be reconsidered in view of our data.
@article{saunders_revision_1993,
title = {Revision of the {Kelp} {Family} {Alariceae} and the {Taxonomic} {Affinities} of {Lessoniopsis}-{Reinke} ({Laminariales}, {Phaeophyta})},
volume = {261},
shorttitle = {Revision of the {Kelp} {Family} {Alariceae} and the {Taxonomic} {Affinities} of {Lessoniopsis}-{Reinke} ({Laminariales}, {Phaeophyta})},
doi = {10.1007/978-94-011-1998-6_93},
abstract = {The morphologically diverse members of the Laminariales are separated into three families, the Alariaceae, Laminariaceae and Lessoniaceae, on the basis of developmental features exhibited at the stipe-blade transition zone. We have investigated the relationships of lessoniacean taxa with those of alariacean and laminariacean affinity. This was done by completing phylogenetic analyses of 3' small-subunit (SSU) rRNA gene (113 bp), first internal transcribed spacer (ITS 1), 5.8S rRNA gene and second internal transcribed spacer (ITS2)(12 bp) sequence data from a variety of taxa. In summary, the Alariaceae and Lessoniaceae are polyphyletic. We present a restricted view of the Alariaceae, including only Alaria and Pterygophora of the genera usually placed in this family, and transfer the monotypic genus Lessoniopsis to this group. Current theories of kelp evolution and biogeography must be reconsidered in view of our data.},
journal = {Hydrobiologia},
author = {Saunders, G. W. and Druehl, L. D.},
month = jun,
year = {1993},
keywords = {Laminariales, Lessoniopsis, Phaeophyta},
pages = {689--697},
}
Downloads: 0
{"_id":"feAuvfc8hMe7qcsp7","bibbaseid":"saunders-druehl-revisionofthekelpfamilyalariceaeandthetaxonomicaffinitiesoflessoniopsisreinkelaminarialesphaeophyta-1993","downloads":0,"creationDate":"2015-08-24T17:48:41.567Z","title":"Revision of the Kelp Family Alariceae and the Taxonomic Affinities of Lessoniopsis-Reinke (Laminariales, Phaeophyta)","author_short":["Saunders, G. W.","Druehl, L. D."],"year":1993,"bibtype":"article","biburl":"http://bibbase.org/zotero/BMSC","bibdata":{"bibtype":"article","type":"article","title":"Revision of the Kelp Family Alariceae and the Taxonomic Affinities of Lessoniopsis-Reinke (Laminariales, Phaeophyta)","volume":"261","shorttitle":"Revision of the Kelp Family Alariceae and the Taxonomic Affinities of Lessoniopsis-Reinke (Laminariales, Phaeophyta)","doi":"10.1007/978-94-011-1998-6_93","abstract":"The morphologically diverse members of the Laminariales are separated into three families, the Alariaceae, Laminariaceae and Lessoniaceae, on the basis of developmental features exhibited at the stipe-blade transition zone. We have investigated the relationships of lessoniacean taxa with those of alariacean and laminariacean affinity. This was done by completing phylogenetic analyses of 3' small-subunit (SSU) rRNA gene (113 bp), first internal transcribed spacer (ITS 1), 5.8S rRNA gene and second internal transcribed spacer (ITS2)(12 bp) sequence data from a variety of taxa. In summary, the Alariaceae and Lessoniaceae are polyphyletic. We present a restricted view of the Alariaceae, including only Alaria and Pterygophora of the genera usually placed in this family, and transfer the monotypic genus Lessoniopsis to this group. Current theories of kelp evolution and biogeography must be reconsidered in view of our data.","journal":"Hydrobiologia","author":[{"propositions":[],"lastnames":["Saunders"],"firstnames":["G.","W."],"suffixes":[]},{"propositions":[],"lastnames":["Druehl"],"firstnames":["L.","D."],"suffixes":[]}],"month":"June","year":"1993","keywords":"Laminariales, Lessoniopsis, Phaeophyta","pages":"689–697","bibtex":"@article{saunders_revision_1993,\n\ttitle = {Revision of the {Kelp} {Family} {Alariceae} and the {Taxonomic} {Affinities} of {Lessoniopsis}-{Reinke} ({Laminariales}, {Phaeophyta})},\n\tvolume = {261},\n\tshorttitle = {Revision of the {Kelp} {Family} {Alariceae} and the {Taxonomic} {Affinities} of {Lessoniopsis}-{Reinke} ({Laminariales}, {Phaeophyta})},\n\tdoi = {10.1007/978-94-011-1998-6_93},\n\tabstract = {The morphologically diverse members of the Laminariales are separated into three families, the Alariaceae, Laminariaceae and Lessoniaceae, on the basis of developmental features exhibited at the stipe-blade transition zone. We have investigated the relationships of lessoniacean taxa with those of alariacean and laminariacean affinity. This was done by completing phylogenetic analyses of 3' small-subunit (SSU) rRNA gene (113 bp), first internal transcribed spacer (ITS 1), 5.8S rRNA gene and second internal transcribed spacer (ITS2)(12 bp) sequence data from a variety of taxa. In summary, the Alariaceae and Lessoniaceae are polyphyletic. We present a restricted view of the Alariaceae, including only Alaria and Pterygophora of the genera usually placed in this family, and transfer the monotypic genus Lessoniopsis to this group. Current theories of kelp evolution and biogeography must be reconsidered in view of our data.},\n\tjournal = {Hydrobiologia},\n\tauthor = {Saunders, G. W. and Druehl, L. D.},\n\tmonth = jun,\n\tyear = {1993},\n\tkeywords = {Laminariales, Lessoniopsis, Phaeophyta},\n\tpages = {689--697},\n}\n\n\n\n","author_short":["Saunders, G. W.","Druehl, L. D."],"key":"saunders_revision_1993-1","id":"saunders_revision_1993-1","bibbaseid":"saunders-druehl-revisionofthekelpfamilyalariceaeandthetaxonomicaffinitiesoflessoniopsisreinkelaminarialesphaeophyta-1993","role":"author","urls":{},"keyword":["Laminariales","Lessoniopsis","Phaeophyta"],"metadata":{"authorlinks":{}},"downloads":0,"html":""},"search_terms":["revision","kelp","family","alariceae","taxonomic","affinities","lessoniopsis","reinke","laminariales","phaeophyta","saunders","druehl"],"keywords":["laminariales","lessoniopsis","phaeophyta"],"authorIDs":[],"dataSources":["cojDQSsxW9McYnKzu","5xMNsBjXAchdDg3cd"]}