Analysis of FMRP mRNA target datasets reveals highly associated mRNAs mediated by G-quadruplex structures formed via clustered WGGA sequences. Suhl, J. a, Chopra, P., Anderson, B. R, Bassell, G. J, & Warren, S. T Human molecular genetics, 23(20):5479–5491, May, 2014. ![Analysis of FMRP mRNA target datasets reveals highly associated mRNAs mediated by G-quadruplex structures formed via clustered WGGA sequences. [link]](https://bibbase.org/img/filetypes/link.svg "link")
Paper doi abstract bibtex Fragile X syndrome, a common cause of intellectual disability and a well-known cause of autism spectrum disorder, is the result of loss or dysfunction of fragile X mental retardation protein (FMRP), a highly selective RNA-binding protein and translation regulator. A major research priority has been the identification of the mRNA targets of FMRP, particularly as recent studies suggest an excess of FMRP targets among genes implicated in idiopathic autism and schizophrenia. Several large-scale studies have attempted to identify mRNAs bound by FMRP through several methods, each generating a list of putative target genes, leading to distinct hypotheses by which FMRP recognizes its targets; namely, by RNA structure or sequence. However, no in depth analyses have been performed to identify the level of consensus among the studies. Here, we analyze four large FMRP target datasets to generate high-confidence consensus lists, and examine all datasets for sequence elements within the target RNAs to validate reported FMRP binding motifs (GACR, ACUK and WGGA). We found GACR to be highly enriched in FMRP datasets, while ACUK was not. The WGGA pattern was modestly enriched in several, but not all datasets. The previous association between FMRP and G-quadruplexes prompted the analysis of the distribution of WGGA in the target genes. Consistent with the requirements for G-quadruplex formation, we observed highly clustered WGGA motifs in FMRP targets compared with other genes, implicating both RNA structure and sequence in the recognition motif of FMRP. In addition, we generate a list of the top 40 FMRP targets associated with FXS-related phenotypes.
@article{Suhl2014,
title = {Analysis of {FMRP} {mRNA} target datasets reveals highly associated {mRNAs} mediated by {G}-quadruplex structures formed via clustered {WGGA} sequences.},
volume = {23},
issn = {1460-2083},
url = {http://www.ncbi.nlm.nih.gov/pubmed/24876161},
doi = {10.1093/hmg/ddu272},
abstract = {Fragile X syndrome, a common cause of intellectual disability and a well-known cause of autism spectrum disorder, is the result of loss or dysfunction of fragile X mental retardation protein (FMRP), a highly selective RNA-binding protein and translation regulator. A major research priority has been the identification of the mRNA targets of FMRP, particularly as recent studies suggest an excess of FMRP targets among genes implicated in idiopathic autism and schizophrenia. Several large-scale studies have attempted to identify mRNAs bound by FMRP through several methods, each generating a list of putative target genes, leading to distinct hypotheses by which FMRP recognizes its targets; namely, by RNA structure or sequence. However, no in depth analyses have been performed to identify the level of consensus among the studies. Here, we analyze four large FMRP target datasets to generate high-confidence consensus lists, and examine all datasets for sequence elements within the target RNAs to validate reported FMRP binding motifs (GACR, ACUK and WGGA). We found GACR to be highly enriched in FMRP datasets, while ACUK was not. The WGGA pattern was modestly enriched in several, but not all datasets. The previous association between FMRP and G-quadruplexes prompted the analysis of the distribution of WGGA in the target genes. Consistent with the requirements for G-quadruplex formation, we observed highly clustered WGGA motifs in FMRP targets compared with other genes, implicating both RNA structure and sequence in the recognition motif of FMRP. In addition, we generate a list of the top 40 FMRP targets associated with FXS-related phenotypes.},
number = {20},
journal = {Human molecular genetics},
author = {Suhl, Joshua a and Chopra, Pankaj and Anderson, Bart R and Bassell, Gary J and Warren, Stephen T},
month = may,
year = {2014},
pmid = {24876161},
keywords = {\#nosource},
pages = {5479--5491},
}
Downloads: 0
{"_id":"HruxXsp8bSRYSDfP3","bibbaseid":"suhl-chopra-anderson-bassell-warren-analysisoffmrpmrnatargetdatasetsrevealshighlyassociatedmrnasmediatedbygquadruplexstructuresformedviaclusteredwggasequences-2014","author_short":["Suhl, J. a","Chopra, P.","Anderson, B. R","Bassell, G. J","Warren, S. T"],"bibdata":{"bibtype":"article","type":"article","title":"Analysis of FMRP mRNA target datasets reveals highly associated mRNAs mediated by G-quadruplex structures formed via clustered WGGA sequences.","volume":"23","issn":"1460-2083","url":"http://www.ncbi.nlm.nih.gov/pubmed/24876161","doi":"10.1093/hmg/ddu272","abstract":"Fragile X syndrome, a common cause of intellectual disability and a well-known cause of autism spectrum disorder, is the result of loss or dysfunction of fragile X mental retardation protein (FMRP), a highly selective RNA-binding protein and translation regulator. A major research priority has been the identification of the mRNA targets of FMRP, particularly as recent studies suggest an excess of FMRP targets among genes implicated in idiopathic autism and schizophrenia. Several large-scale studies have attempted to identify mRNAs bound by FMRP through several methods, each generating a list of putative target genes, leading to distinct hypotheses by which FMRP recognizes its targets; namely, by RNA structure or sequence. However, no in depth analyses have been performed to identify the level of consensus among the studies. Here, we analyze four large FMRP target datasets to generate high-confidence consensus lists, and examine all datasets for sequence elements within the target RNAs to validate reported FMRP binding motifs (GACR, ACUK and WGGA). We found GACR to be highly enriched in FMRP datasets, while ACUK was not. The WGGA pattern was modestly enriched in several, but not all datasets. The previous association between FMRP and G-quadruplexes prompted the analysis of the distribution of WGGA in the target genes. Consistent with the requirements for G-quadruplex formation, we observed highly clustered WGGA motifs in FMRP targets compared with other genes, implicating both RNA structure and sequence in the recognition motif of FMRP. In addition, we generate a list of the top 40 FMRP targets associated with FXS-related phenotypes.","number":"20","journal":"Human molecular genetics","author":[{"propositions":[],"lastnames":["Suhl"],"firstnames":["Joshua","a"],"suffixes":[]},{"propositions":[],"lastnames":["Chopra"],"firstnames":["Pankaj"],"suffixes":[]},{"propositions":[],"lastnames":["Anderson"],"firstnames":["Bart","R"],"suffixes":[]},{"propositions":[],"lastnames":["Bassell"],"firstnames":["Gary","J"],"suffixes":[]},{"propositions":[],"lastnames":["Warren"],"firstnames":["Stephen","T"],"suffixes":[]}],"month":"May","year":"2014","pmid":"24876161","keywords":"#nosource","pages":"5479–5491","bibtex":"@article{Suhl2014,\n\ttitle = {Analysis of {FMRP} {mRNA} target datasets reveals highly associated {mRNAs} mediated by {G}-quadruplex structures formed via clustered {WGGA} sequences.},\n\tvolume = {23},\n\tissn = {1460-2083},\n\turl = {http://www.ncbi.nlm.nih.gov/pubmed/24876161},\n\tdoi = {10.1093/hmg/ddu272},\n\tabstract = {Fragile X syndrome, a common cause of intellectual disability and a well-known cause of autism spectrum disorder, is the result of loss or dysfunction of fragile X mental retardation protein (FMRP), a highly selective RNA-binding protein and translation regulator. A major research priority has been the identification of the mRNA targets of FMRP, particularly as recent studies suggest an excess of FMRP targets among genes implicated in idiopathic autism and schizophrenia. Several large-scale studies have attempted to identify mRNAs bound by FMRP through several methods, each generating a list of putative target genes, leading to distinct hypotheses by which FMRP recognizes its targets; namely, by RNA structure or sequence. However, no in depth analyses have been performed to identify the level of consensus among the studies. Here, we analyze four large FMRP target datasets to generate high-confidence consensus lists, and examine all datasets for sequence elements within the target RNAs to validate reported FMRP binding motifs (GACR, ACUK and WGGA). We found GACR to be highly enriched in FMRP datasets, while ACUK was not. The WGGA pattern was modestly enriched in several, but not all datasets. The previous association between FMRP and G-quadruplexes prompted the analysis of the distribution of WGGA in the target genes. Consistent with the requirements for G-quadruplex formation, we observed highly clustered WGGA motifs in FMRP targets compared with other genes, implicating both RNA structure and sequence in the recognition motif of FMRP. In addition, we generate a list of the top 40 FMRP targets associated with FXS-related phenotypes.},\n\tnumber = {20},\n\tjournal = {Human molecular genetics},\n\tauthor = {Suhl, Joshua a and Chopra, Pankaj and Anderson, Bart R and Bassell, Gary J and Warren, Stephen T},\n\tmonth = may,\n\tyear = {2014},\n\tpmid = {24876161},\n\tkeywords = {\\#nosource},\n\tpages = {5479--5491},\n}\n\n","author_short":["Suhl, J. a","Chopra, P.","Anderson, B. R","Bassell, G. J","Warren, S. T"],"key":"Suhl2014","id":"Suhl2014","bibbaseid":"suhl-chopra-anderson-bassell-warren-analysisoffmrpmrnatargetdatasetsrevealshighlyassociatedmrnasmediatedbygquadruplexstructuresformedviaclusteredwggasequences-2014","role":"author","urls":{"Paper":"http://www.ncbi.nlm.nih.gov/pubmed/24876161"},"keyword":["#nosource"],"metadata":{"authorlinks":{}},"html":""},"bibtype":"article","biburl":"https://bibbase.org/zotero/eric.larG4","dataSources":["5L2zM5wNE5CBYNuea"],"keywords":["#nosource"],"search_terms":["analysis","fmrp","mrna","target","datasets","reveals","highly","associated","mrnas","mediated","quadruplex","structures","formed","via","clustered","wgga","sequences","suhl","chopra","anderson","bassell","warren"],"title":"Analysis of FMRP mRNA target datasets reveals highly associated mRNAs mediated by G-quadruplex structures formed via clustered WGGA sequences.","year":2014}